Package: packageRank 0.9.5.9004

packageRank: Computation and Visualization of Package Download Counts and Percentile Ranks

Compute and visualize package download counts and percentile ranks from Posit/RStudio's CRAN mirror.

Authors:lindbrook [aut, cre]

packageRank_0.9.5.9004.tar.gz
packageRank_0.9.5.9004.zip(r-4.5)packageRank_0.9.5.9004.zip(r-4.4)packageRank_0.9.5.9004.zip(r-4.3)
packageRank_0.9.5.9004.tgz(r-4.5-any)packageRank_0.9.5.9004.tgz(r-4.4-any)packageRank_0.9.5.9004.tgz(r-4.3-any)
packageRank_0.9.5.9004.tar.gz(r-4.5-noble)packageRank_0.9.5.9004.tar.gz(r-4.4-noble)
packageRank_0.9.5.9004.tgz(r-4.4-emscripten)packageRank_0.9.5.9004.tgz(r-4.3-emscripten)
packageRank.pdf |packageRank.html
packageRank/json (API)
NEWS

# Install 'packageRank' in R:
install.packages('packageRank', repos = c('https://lindbrook.r-universe.dev', 'https://cloud.r-project.org'))

Bug tracker:https://github.com/lindbrook/packagerank/issues

Datasets:
  • blog.data - Blog post data.
  • rstudio.logs - Eight RStudio Download Logs to Fix Duplicate Logs Errors in 'cranlogs'.

On CRAN:

Conda:

bioconductor-packages

6.12 score 29 stars 27 scripts 685 downloads 39 exports 56 dependencies

Last updated 12 hours agofrom:0f71bd7f75. Checks:9 OK. Indexed: yes.

TargetResultLatest binary
Doc / VignettesOKMar 30 2025
R-4.5-winOKMar 30 2025
R-4.5-macOKMar 30 2025
R-4.5-linuxOKMar 30 2025
R-4.4-winOKMar 30 2025
R-4.4-macOKMar 30 2025
R-4.4-linuxOKMar 30 2025
R-4.3-winOKMar 30 2025
R-4.3-macOKMar 30 2025

Exports:bioconductorDownloadsbioconductorRankcountryDistributioncountryPackagecountsRankscranDistributioncranDownloadscranInflationPlotcranMirrorscurrentTimedownloadsCountryfilteredDownloadsinflationPlotinflationPlot2ipCountipDownloadsipPackagelocalTimelogDatelogInfomonthlyLogpackageCountrypackageDistributionpackageHistorypackageLogpackageRankpackageVersionPercentplotDownloadsCountryplotTopCountryCodesqueryCountqueryPackagequeryPercentilequeryRankrLogtopCountryCodesutcutc0versionPlotweeklyDownloads

Dependencies:askpassbitopscachemclicolorspacecpp11cranlogscurldata.tabledplyrfansifarverfastmapgenericsggplot2gluegtablehttrisobandISOcodesjsonlitelabelinglatticelifecyclelubridatemagrittrMASSMatrixmemoisemgcvmimemunsellnlmeopensslpillarpkgconfigpkgsearchR.methodsS3R.ooR.utilsR6RColorBrewerRCurlrlangrversionsscalessugrrantssystibbletidyselecttimechangeutf8vctrsviridisLitewithrxml2

Readme and manuals

Help Manual

Help pageTopics
packageRankpackageRank-package
Annual/monthly package downloads from Bioconductor.bioconductorDownloads
Package download counts and rank percentiles.bioconductorRank
Blog post data.blog.data
Tabulate package downloads by country.countryDistribution
Tabulate a country's package downloads.countryPackage
Counts v. Rank Percentiles for 'cholera' for First Week of March 2020.countsRanks
CRAN distribution (prototype).cranDistribution
Daily package downloads from the RStudio CRAN mirror.cranDownloads
CRAN inflation plot.cranInflationPlot
Scrape CRAN Mirrors data.cranMirrors
Compute Current Time in Selected Time Zone.currentTime
Compute Downloads by Country Code.downloadsCountry
Filtered package downloads from the RStudio CRAN mirror (prototype).filteredDownloads
Inflation plots of effects of "small" downloads and prior versions for October 2019: 'cholera', 'ggplot2', and 'VR'.inflationPlot
Inflation plots of effects of "small" downloads on aggregate CRAN downloads for October 2019 and July 2020.inflationPlot2
Count number of IP addresses.ipCount
Unique package download counts by IP address.ipDownloads
Tabulate an IP's package downloads.ipPackage
Compute Local Time from Coordinated Universal Time (UTC/GMT).localTime
Compute Effective CRAN Log Date Based on Local and UTC Time (prototype).logDate
Compute Availability, Date, Time of "Today's" Log.logInfo
Get CRAN logs for selected month.monthlyLog
Package download counts by country.packageCountry
Package Download Distribution.packageDistribution
Extract package or R version history.packageHistory
Get Package Download Logs.packageLog
Package download counts and rank percentiles.packageRank
Compute data for versionPlot().packageVersionPercent
Plot method for bioconductorDownloads().plot.bioconductorDownloads
Plot method for bioconductorRank().plot.bioconductorRank
Plot top 10 package downloads by country domain.plot.countryDistribution
Plot method for countsRanks().plot.countsRanks
Plot method for cranDistribution().plot.cranDistribution
Plot method for cranDownloads().plot.cranDownloads
Plot method for packageDistribution().plot.packageDistribution
Plot method for packageRank() and packageRank0().plot.packageRank
Plot method for packageVersionPercent().plot.packageVersionPercent
Plot method for weeklyDownloads().plot.weeklyDownloads
Plot Compute Downloads by Country Code.plotDownloadsCountry
Plot Top N Downloads by Country Code.plotTopCountryCodes
Print method for bioconductorDownloads().print.bioconductorDownloads
Print method for bioconductorRank().print.bioconductorRank
Print method for countryDistribution().print.countryDistribution
Print method for cranDistribution().print.cranDistribution
Print method for cranDownloads().print.cranDownloads
Print method for packageDistribution().print.packageDistribution
Print method for packageRank().print.packageRank
Query download count.queryCount
Query package name.queryPackage
Percentile-rank query.queryPercentile
Rank query.queryRank
Get R Application Download Logs.rLog
Eight RStudio Download Logs to Fix Duplicate Logs Errors in 'cranlogs'.rstudio.logs
Summary method for bioconductorDownloads().summary.bioconductorDownloads
Summary method for bioconductorRank().summary.bioconductorRank
Summary method for cranDistribution().summary.cranDistribution
Summary method for cranDownloads().summary.cranDownloads
Summary method for packageRank().summary.packageRank
Compute Top N Downloads by Country Code.topCountryCodes
Compute Coordinated Universal Time (UTC/GMT) for Your Local Time.utc
Compute Coordinated Universal Time (UTC/GMT) for Specified Local Time.utc0
Version Plot.versionPlot
Sample Weekly CRAN Downloads Data.weeklyDownloads